Login   Register  
PHP Classes
elePHPant
Icontem

File: pictcaptcha_conf.php

Recommend this page to a friend!
Stumble It! Stumble It! Bookmark in del.icio.us Bookmark in del.icio.us
  Classes of Patricio Cardó  >  Pict CAPTCHA  >  pictcaptcha_conf.php  >  Download  
File: pictcaptcha_conf.php
Role: Configuration script
Content type: text/plain
Description: configuration variable
Class: Pict CAPTCHA
CAPTCHA validation making the user select pictures
Author: By
Last change:
Date: 1 year ago
Size: 9,887 bytes
 

Contents

Class file image Download
<?php
$pict_capt_vars 
= array(
    
"phrases" => array("help"=>"help""reload"=>"reload de drawing"
                    
"noscript"=>"You must enable JavaScript in your browser to use this element!",
                    
"instructions"=>"<strong>Instructions</strong>
                                    <ol>
                                        <li>If you don't understand the drawing, click  
                                            reload(<img src='{@reload_image@}' border='0' />) button until
                                            the drawing is readable</li>
                                        <li>Select images
                                            <ol>
                                                <li>Click [â–¾] button, a photo list should be displayed</li>
                                                <li>Scroll photo list until display the photo correspondig
                                                 to the drawn entity in the correct position</li>
                                                <li>Click the corresponding photo</li>
                                                <li>Repeat the task until all drawn entity have their
                                                corresponding photo in the right order</li>
                                            </ol>
                                        </li>
                                    </ol>"
,
                    
"whyisit"=> "<br /><strong>Why requesting this?</strong>
                                <br />This form element is a CAPTCHA (acr. 'Completely Automated Public Turing test
                                to Tell Computers and Human Aparts'), the aim of it is to avoid automated website attacks 
                                and protect users."
),

    
"quantity" => 2,
    
"pixel" => "2px",
    
"onlyfromallowed" => true/*
        Set it to false if you want to allow unknown external servers to call the script (risk of frame-bost);
    */
    
"referers" => array(), // IPS or domain names that are allowed to call the script when onlyfromallowed is true
    
    // internal variables
    
"objects" => array(
        
"manzana" => array("pic"=>"MANAMBNBMCNCNDODQDRDSDTDUDVDWDXDNEOEPEQEYEZEaEIFJFKFLFMFNFOFaFbFGGHGNGOGPGcGdGFHNHOHPHQHeHDIEIMIOIQIbIcIdIeIDJNJOJPJaJbJdJeJCKaKcKCLZLaLcLBMYMZMbMBNYNbNBOYObOBPYPbPBQYQbQcQBRYRZRbRcRCSZSaSbSCTZTbTCUZUbUDVaVcVdVDWaWdWeWEXaXbXeXFYcYdYeYFZeZFaeaGbebGcdcHdcdHebeceHfIfZfafIgPgQgRgSgYgZgJhKhLhMhNhOhShThUhVhWhXh""img"=>"5336111089_b3023a9c44_s.jpg"),
        
"banana" => array("pic"=>"DCECFCDDGDDEFEHEDFHFDGGGDHGHDIHIIIDJEJGJIJJJDKGKJKKKDLELHLKLLLEMHMLMENFNINLNMNFOJOMONOFPKPNPFQGQKQNQOQGRLRORPRGSMSPSQSGTHTMTQTRTHUNURUSUTUHVIVOVTVUVIWPWUWVWIXJXQXVXWXXXJYKYRYSYXYYYZYKZLZTZUZZZaZbZLaMaVaWabacadaeaMbNbXbYbZbabdbebfbNcOcPcdcecfcPdQdRdSdddedfdSeTeUeVeWeaebecedeeeVfWfXfYfZfaf""img"=>"6612824761_3f66a93c71_m.jpg"),
        
"estrella" => array("pic"=>"PAPBOCPCQCODQDOEQENFRFNGRGMHNHRHSHMISIMJSJTJLKMKTKALBLCLDLELFLGLHLILJLKLLLTLULVLWLXLYLZLaLbLcLdLeLfLBMCMdMeMDNENcNdNEOFOZOaObOGPHPXPYPZPIQJQVQWQXQKRVRJSKSWSJTPTQTWTIUOUPUQURUXUIVNVRVSVXVYVHWLWMWNWSWTWUWYWHXKXLXUXVXZXGYJYKYVYWYZYGZIZJZXZaZFaGaHaIaYaaaFbGbZbab""img"=>"4505781946_ce1d1afe6f_m.jpg"),
        
"lapiz" => array("pic"=>"YDZDaDbDWEXEcEVFYFdFUGZGdGTHYHaHdHRISIXIbIdIQJVJWJcJdJPKUKbKOLTLZLaLbLMMNMSMYMZMLNRNXNYNLOQOWOXOJPKPPPVPWPIQNQOQTQUQHRMRSRTRFSGSLSRSSSETFTKTQTRTDUFUJUOUPUDVGVIVNVOVCWHWMWNWCXIXKXLXCYJYKYBZCZDZHZIZBaCaDaEaFaGaHaBbCbDb""img"=>"6370278923_48d6b3bb4d_m.jpg"),
        
"auto" => array("pic"=>"KELEMENEOEPEQERESETEUEJFLFPFQFRFSFUFVFIGKGPGTGUGWGHHJHPHUHXHGIIIPIVIYICJDJEJFJIJJJKJLJMJNJOJPJQJRJSJTJUJVJWJXJYJZJaJbJcJdJeJfJBKIKPKXKgKhKBLILPLQLRLXLgLiLBMIMJMKMPMXMgMiMBNCNDNENFNGNINJNKNLNPNXNYNZNaNcNdNeNfNgNhNiNBOHOLOMOPOWOXObOiOBPGPJPMPNPPPVPWPZPcPiPCQDQEQFQGQIQKQMQNQOQPQQQRQSQTQUQVQWQYQaQcQdQeQfQgQhQGRJRMRWRZRcRHSLSXSbSITJTKTYTZTaT""img"=>"5191643143_e0d79a73f9_m.jpg"),
        
"pato" => array("pic"=> "NDODPDQDMERELFOFSFLGNGOGPGTGGHHHIHJHKHLHOHTHFIMITIEJFJGJHJIJJJKJLJMJNJTJFKGKNKTKHLILJLKLLLMLTLMMTMMNTNMOTOMPRPSPUPLQQQVQLRQRWRXRYRZRaRLSQSZSLTQTZTaTLURUXUYUZULVSVTVUVVVWVXVcVdVLWYWZWaWbWdWMXdXNYcYOZSZTZUZbZPaQaSaVaaaQbRbWbXbYbZbNcOcPcScTcWcOdSdUdWdNeReUeWeNfOfPfQfTfUfWfSgXgShVhXhTiUiWi""img"=>"2363124458_ce608e5a6c_m.jpg"),
        
"arbol" => array("pic"=>"OAPAQARASAIBJBKBLBMBNBOBSBTBICTCFDGDHDIDTDUDVDWDXDFEJESEXEYEEFYFEGYGZGEHXHYHZHaHEIFIaIFJaJDKEKFKGKaKDLaLEMZMaMENFNYNZNFOWOXOEPXPEQYQERYRFSGSHSPSWSXSHTKTLTMTNTOTPTQTSTWTHUIUJUKUNUPUQURUSUTUUUVUWUNVQVVVWVNWPWNXPXMYPYMZPZMaPaMbPbMcQcKdLdRdJeKeLeMeNeReSeOfPfQfRf""img"=>"1475225158_6f04c95e9d_m.jpg"),
        
"silla" => array("pic"=>"LDMDNDODIEJEKEOEHFOFHGOGHHOHHIOIHJOJHKOKHLMLNLOLHMKMLMMMOMHNINJNMNONHOJOMOOOHPJPMPOPHQJQMQNQOQHRJRMRPRQRRRSRTRURVRWRXRHSJSKSLSWSXSHTJTWTXTHUJUKUVUXUHVLVMVNVOVPVQVRVSVTVUVXVHWVWXWHXKXLXMXNXOXPXQXRXSXUXVXXXHYJYSYUYVYXYHZJZSZUZVZXZHaJaSaUaVaXaHbJbSbUbVbXbHcJcScUcVcXcGdHdJdSdUdVdXdGeJeSeUeVeWeXeGfIfJfSfUfGgIgSgUgGhHhIhShThUh",
"img"=>"6867873676_8dc9fdf03b_m.jpg"),
        
"mano" => array("pic"=> "RASATAMBNBOBRBTBUBLCPCRCUCLDPDRDVDJEKELEQEREVEIFLFMFQFRFVFIGMGNGRGSGWGIHNHRHSHWHJINIOISIWIJJKJOJPJSJTJXJfJgJhJIKJKKKLKPKXKeKfKiKHLILKLLLMLQLYLeLiLHMLMMMYMZMdMiMINMNNNZNaNcNdNhNIONObOcOhOJPKPgPhPKQLQgQLRfRgRMSeSfSMTNTeTNUOUdUeUOVPVdVPWdWQXcXdXQYRYdYRZSZdZSaTadaeaTbUbebUcVcecfcVdWdfdWefegeWfgfWgXggghgXhhhXi""img"=>"5836857001_e0825620d2_m.jpg"),
        
"ojo" => array("pic"=>"NIOIPIQIRISITIUIVIKJLJMJOJSJTJWJXJHKIKJKNKRKSKTKUKYKZKGLHLNLQLRLSLTLULVLYLZLaLbLFMGMNMQMRMSMTMUMVMYMcMENFNNNRNSNTNUNYNdNFOOOSOTOXOeOGPHPOPXPfPHQIQJQPQQQVQWQeQfQgQKRLRRRSRTRURgRMSNSOScSdSeSfSOTPTQTRTSTTTUTVTWTXTYTZTaTbT""img"=>"292958125_cb2968235b_m.jpg"),
        
"guitarra" => array("pic"=>"CCDCECBDFDAEDEGEBFEFHFCGIGDHEHFHHHJHGIKIHJJJLJIKMKJLLLNLKMOMLNNNPNMOQOSOTOUONPQPRPVPWPOQPQSQXQORQRTRYROSRSUSZSNTSTVTaTNUTUWUaUNVUVWVXVYVbVNWOWVWWWXWZWcWdWeWNXPXVXXXYXZXfXNYPYVYWYYYZYaYfYNZQZRZSZWZXZYZbZgZOaTaYaaagaPbQbRbSbUbZbgbTcUcYcgcTdUdfdgdTeUeVeeegeUfWfXfcfdfffUgYgZgagbgfgVhWhdhehXiYiZiaibici",
"img"=>"314496987_753d74d136_m.jpg"),
        
"vaso" => array("pic"=>"MCNCOCPCQCRCSCTCJDKDLDUDVDWDHEIEXEYEGFZFGGHGYGZGGHIHJHWHXHZHGIKILIMITIUIVIZIGJNJOJPJQJRJSJZJGKZKGLZLGMZMGNZNGOZOGPZPHQYQHRYRHSYSHTYTHUYUHVYVHWIWXWYWIXXXIYXYIZXZIaXaIbJbObPbRbSbWbXbJcMcUcWcJdKdWdJeWeKfLfUfVfMgNgOgPgQgRgSgTg",
"img"=>"6599447253_a90c1191d9_m.jpg"),
        
"gato" => array ("pic"=>"HBVBHCICUCVCHDJDMDNDODPDQDTDVDHEKELERESEVEIFJFTFUFIGUGHHJHKHLHQHRHSHVHHIIIKIMIPIRITIVIHJJJKJLJQJRJSJVJHKVKHLMLNLOLVLfLgLFMGMHMIMJMKMNMQMRMSMTMUMVMeMhMINKNNNQNRNTNeNhNGOHOJOLOMOOOPOROSOUOVOeOhOIPKPQPTPVPePhPHQLQMQNQOQPQVQWQXQeQhQLRXReRhRLSYSfShSLTZTfThTLUaUfUhULVaVbVfVhVLWPWbWfWhWLXQXcXfXhXLYMYPYQYRYcYfYhYMZPZRZUZXZdZfZhZMaPaRaUaWadaeafahaMbPbRbUbWbdbebhbMcPcRcUcVcXcgcLdMdPdRdUdWdXdYdZdadgdKeLePeQeUeVeeefeKfLfMfNfOfQfRfSfTfUfWfXfYfZfafbfcfdf",
"img"=>"2573196546_0c3133104a_m.jpg"),
        
"perro" => array ("pic"=>"LCMCNCOCPCQCRCSCIDJDKDSDTDIETEUEVEWEGFHFIFNFOFWFDGEGFGGGNGOGTGXGDHEHFHTHUHVHXHDIEIFIVIWIXIEJFJGJHJIJJJVJEKHKKKLKVKLLVLWLFMHMJMKMWMGNINONXNGOKOLOMONOXOHPIPJPNPXPNQYQMRYRMSZSMTZTaTMUaUMVaVMWbWMXOXRXbXLYMYOYRYbYcYLZOZRZWZcZKaLaOaQaVacaKbNbObQbUbcbKcNcQcRcScTcUcdcJdMdNdQdUdddJeMePeTeUedeeefegeheIfLfOfPfSfafhfIgJgKgLgMgNgOgSgTgUgVgWgXgYgZgbgcgdgegfggghg",
"img"=>"5665211560_59a1fe3701_m.jpg"),
        
"mariposa" => array("pic"=>"GCHCICJCKCEDFDLDEELEMESEDFMFSFDGMGNGSGYGDHNHSHTHUHVHXHDIOIRITIWIXIDJOJPJRJVJWJDKQKRKWKbKcKdKeKfKDLQLSLVLYLZLaLfLgLDMQMTMUMWMXMgMENPNUNgNEOFOPOUOgOFPPPTPgPFQPQTQfQgQFRPRTRfRFSPSSSeSFTOTPTSTcTdTFUOURUSUaUbUDVEVNVOVPVRVZVCWDWLWMWPWQWZWCXKXRXYXCYJYRYYYCZIZSZYZDaEaFaGaHaSaYaTbYbTcYcUdYdVeWeXe""img"=>"6047918145_5c1a929a16_m.jpg"),
        
"casa" => array(
"pic"=>"KAMAPAJBOBGCHCMCNCUCWCYCFDKDUDVDWDXDYDIEJEUEWEYEEFFFGFHFWFEGHGWGEHHHJHKHLHMHNHOHPHQHRHSHTHUHVHWHXHYHZHaHEIHIIIKILIWIbIEJHJLJWJcJEKGKMKWKdKELFLNLeLEMOMfMDNENONPNgNCODOEOOOQOROSOTOUOVOWOXOYOZOaObOcOdOeOfOgOhOEPOPfPEQOQfQERHRIRJRKRLRORTRURVRWRXRYRZRfRESHSLSOSTSWSZSfSETHTLTOTTTWTZTfTEUHULUOUTUWUZUfUEVHVLVOVTVWVZVfVEWHWJWKWLWOWTWWWZWfWEXHXLXOXTXUXVXWXXXYXZXfXEYHYLYOYfYEZHZLZOZfZEaHaLaOafaEbFbGbHbIbJbKbLbMbNbObPbQbRbSbTbUbVbWbXbYbZbabbbcbdbebfbFcKcLcDdEdJdKdDeIeDfIfJfKfLfDgEgMgFhNhOhFiOi",
"img"=>"320_schwangeres_haus.jpg"),
        
"flor" => array(
"pic"=>"MANAOAPAQARAKBLBSBTBJCTCJDTDUDVDWDXDYDZDaDDEEEGEHEIEJETEUEaEbECFJFTFcFBGKGTGcGBHKHTHcHdHBIKIMINIOIPIQIRISITIcIdIBJLJMJSJTJdJBKLKOKQKTKdKBLKLMLPLRLTLULcLCMKMNMUMbMcMDNKNQNSNUNYNZNaNEOFOLONOPOUOVOWOXOYOFPGPHPIPJPLPMPRPTPZPaPGQHQMQNQRQSQaQbQFRGRNRORPRQRRRbRcRFSQScSETFTQTcTEUQUcUEVPVRVcVEWPWRWcWFXPXRXSXbXFYOYPYRYSYaYbYGZNZRZTZUZVZWZaZGaHaIaJaLaMaRaUaXaYaZaRbUbRcUcRdUdQeUeQfTfQgTgQhThQiTi",
"img"=>"137546658_35362bcf47_m.jpg"),
        
"luna" => array(
"pic"=>"QARASAQBTBUBVBRCVCWCRDSDVDWDXDSETEXEYETFYFZFUGZGaGUHaHUIbIVJbJVKcKVLcLVMcMdMWNdNWOdOWPdPWQdQVRdRVSdSVTdTVUdUVVdVUWVWcWUXcXUYcYUZbZUabaTbabScTcZcRdSdYdReXeQfWfPgQgUgVgNhOhRhShThMiNiOiPiQi",
"img"=>"6332762868_cfecc8f97b.jpg"),
        
"leon" => array(
"pic"=>"VAWAXARBSBTBUBYBZBaBbBQCRCcCPDQDdDeDfDOEfEgENFRFSFVFWFXFYFZFbFcFdFgFhFFGGGHGIGNGQGTGUGaGbGeGhGEHFHIHMHPHTHcHeHhHEIIIMIQIRISIdIeIhIEJIJMJRJTJUJVJZJaJbJdJhJiJDKEKFKGKHKIKMKRKUKVKZKaKdKiKCLGLMLRLdLiLBMCMFMMMRMXMdMiMBNENMNRNWNXNYNdNiNBOEOKOLOMOROdOhOBPDPIPJPMPSPVPXPZPcPhPBQDQHQMQSQVQWQXQYQZQcQhQBRDRGRNRTRWRXRYRbRhRBSDSFSOSUSaShSBTDTETOTVTWTXTYTZTgTBUPUfUgUBVQVfVCWDWIWRWSWeWDXIXSXTXUXcXdXDYIYQYVYWYXYYYZYaYbYcYCZGZHZJZKZLZMZNZQZWZcZCaFaJaMaOaPaQaUaVaWaXabaCbFbJbMbRbUbYbbbCcFcJcMcRcUcYcbcCdGdJdNdRdVdYdcdCeGeJeNeReVeYeceCfDfEfFfGfJfKfLfMfNfRfSfTfUfVfYfZfafbfcf",
"img"=>"5657669257_d4be2a3f98_m.jpg"),
        
/*
        "monitor" => array("pic"=> "L2K2J2I2H3G3F3E3D4C4B4A495857565565758595A5C5B5D5E5F5G5HJ1I1H1G1F1E1D2C2B2A29383736354443425262728292A2B2D2C2E2F2G2H2I2J2K2L2M5I5J5K5L5M5NM2N3N4N5N7N6N8N9NANBNCNDNENFNGNHMILIKIJJIJHJGKFKEKDLCLBLAM9M8M7N6N4N3MFLCMFMFNEODOCNBNAO9O8P9QAQBQCQDQEQFPGOHOINHMGM7778797A7B7D7E7F7G7C7H7I7J7K8K9KAJCJBJDIEIFIGHHHIHJGKGLGLFLELDLCLALBL9L8L6L7L5L4K4J4I5H5G5F5E6D6C6B6A79787", "img"=>"imgs/2576383396_42897aa5a0_o.jpg"),
        */
        
"vibora" => array(
"pic"=>"PAQARASATAUAVAWALBMBNBOBWBXBYBICJCKCLCZCaCGDHDaDbDFEHEIEcEFFHFIFOFPFQFRFSFTFUFVFWFcFdFEGKGOGXGYGdGDHHHIHJHKHNHOHYHdHDIGIKIMINIYIZIdIeIDJEJFJJJKJMJZJeJGKIKJKKKMKZKeKILJLKLLLZLeLHMZMeMGNHNZNeNFOHOYOZOeOHPXPYPePVQWQXQdQeQTRURVRdRQSRSSSTScSdSNTOTPTQTaTbTKULUMUNUZUaUGVHVIVJVKVXVYVZVEWFWVWWWXWEXRXSXTXUXDYOYPYQYRYCZKZLZMZNZOZCaIaJaKaCbHbIbTbUbVbWbXbYbZbabbbcbdbCcIcJcKcLcMcNcOcPcQcRcScTcUcdcecDdZdedfdDeJeKeLeMeNeOePeQeReSeTeUeVeWeXeYefeEfGfHfIfJfffDgEgFgGgegfgBhChDhdhehDiEiFiGiHiIiJiKiLiMiNiOiPiQiRiSiTiUiViWiXiYiZiaibicidi",
"img"=>"136545803_d26f307f08_m.jpg")
    )
    
)
?>